Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family) duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold |
Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein) |
Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species) PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively |
Species Escherichia coli [TaxId:562] [82696] (7 PDB entries) |
Domain d1oy9a2: 1oy9 A:135-181,A:274-330 [87572] Other proteins in same PDB: d1oy9a5, d1oy9a6, d1oy9a7, d1oy9a8 complexed with et |
PDB Entry: 1oy9 (more details), 3.8 Å
SCOPe Domain Sequences for d1oy9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy9a2 d.58.44.1 (A:135-181,A:274-330) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]} sflmvvgvintdgtmtqedisdyvaanmkdaisrtsgvgdvqlfgsqXnydiiaefngqp asglgiklatganaldtaaairaelakmepffpsglkivypydtt
Timeline for d1oy9a2: