Lineage for d1oy1a_ (1oy1 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579489Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 579594Family c.23.16.2: DJ-1/PfpI [52325] (7 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 579653Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species)
    involved in an early stage of isoprenoid biosynthesis; contains a Cys-Glu putative catalytic dyad
  7. 579654Species Escherichia coli [TaxId:562] [89607] (2 PDB entries)
  8. 579657Domain d1oy1a_: 1oy1 A: [87548]

Details for d1oy1a_

PDB Entry: 1oy1 (more details), 2.95 Å

PDB Description: X-Ray Structure Of ElbB From E. Coli. Northeast Structural Genomics Research Consortium (Nesg) Target Er105

SCOP Domain Sequences for d1oy1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oy1a_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli}
mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet
rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal
aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv
dednkivttpaymlaqniaeaasgidklvsrvlvlaelehh

SCOP Domain Coordinates for d1oy1a_:

Click to download the PDB-style file with coordinates for d1oy1a_.
(The format of our PDB-style files is described here.)

Timeline for d1oy1a_: