SCOP 1.65: Domain d1oy1a_: 1oy1 A:

Lineage for d1oy1a_ (1oy1 A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.6: Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89605] (1 protein)
   most similar to the DJ-1/PfpI family; contains a Cys-Glu putative catalytic diad

6. Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species)
   involved in an early stage of isoprenoid biosynthesis

7. Species Escherichia coli [TaxId:562] [89607] (1 PDB entry)

8. Domain d1oy1a_: 1oy1 A: [87548]

Details for d1oy1a_

PDB Entry: 1oy1, 2.95 Å

PDB Description: X-Ray Structure Of ElbB From E. Coli. Northeast Structural Genomics Research Consortium (Nesg) Target Er105

SCOP Domain Sequences for d1oy1a_:

Sequence; same for both SEQRES and ATOM records:

>d1oy1a_ c.23.16.6 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli}
mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet
rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal
aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv
dednkivttpaymlaqniaeaasgidklvsrvlvlaelehh

Timeline for d1oy1a_:

• d1oy1a_ is new in SCOP 1.65
  
• d1oy1a_ appears in SCOP 1.67
  
• d1oy1a_ appears in the current release, SCOPe 2.08, called d1oy1a1