| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (7 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species) involved in an early stage of isoprenoid biosynthesis; contains a Cys-Glu putative catalytic dyad |
| Species Escherichia coli [TaxId:562] [89607] (2 PDB entries) |
| Domain d1oy1d_: 1oy1 D: [87551] structural genomics; NESG target ER105 complexed with mse |
PDB Entry: 1oy1 (more details), 2.95 Å
SCOP Domain Sequences for d1oy1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oy1d_ c.23.16.2 (D:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli}
tmkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamte
trnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelka
laqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddiv
vdednkivttpaymlaqniaeaasgidklvsrvlvla
Timeline for d1oy1d_: