Lineage for d1ox6b2 (1ox6 B:-3-229)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1160006Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1160007Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1160077Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 1160078Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries)
  8. 1160082Domain d1ox6b2: 1ox6 B:-3-229 [87508]
    Other proteins in same PDB: d1ox6a1, d1ox6b1
    complexed with ni, pop, so4

Details for d1ox6b2

PDB Entry: 1ox6 (more details), 2.4 Å

PDB Description: towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase
PDB Compounds: (B:) Imidazole glycerol phosphate synthase hisHF

SCOPe Domain Sequences for d1ox6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox6b2 c.23.16.1 (B:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv
dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek
pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee
fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

SCOPe Domain Coordinates for d1ox6b2:

Click to download the PDB-style file with coordinates for d1ox6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ox6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ox6b1