SCOPe 2.08: Domain d1ox6b2: 1ox6 B:1-229

Lineage for d1ox6b2 (1ox6 B:1-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries)

8. Domain d1ox6b2: 1ox6 B:1-229 [87508]
   Other proteins in same PDB: d1ox6a1, d1ox6a3, d1ox6b1, d1ox6b3
   complexed with ni, pop, so4

Details for d1ox6b2

PDB Entry: 1ox6, 2.4 Å

PDB Description: towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase

PDB Compounds: (B:) Imidazole glycerol phosphate synthase hisHF

SCOPe Domain Sequences for d1ox6b2:

Sequence; same for both SEQRES and ATOM records:

>d1ox6b2 c.23.16.1 (B:1-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}
mpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfvdnl
fnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsekpvp
eigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygseefia
avnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

Timeline for d1ox6b2:

• d1ox6b2 first appeared in SCOP 1.65
  
• d1ox6b2 appears in SCOPe 2.07