Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
Protein Indole-3-pyruvate decarboxylase [89648] (1 species) |
Species Enterobacter cloacae [TaxId:550] [89649] (1 PDB entry) |
Domain d1ovmd2: 1ovm D:3-180 [87471] Other proteins in same PDB: d1ovma1, d1ovma3, d1ovmb1, d1ovmb3, d1ovmc1, d1ovmc3, d1ovmd1, d1ovmd3 complexed with mg, tpp |
PDB Entry: 1ovm (more details), 2.65 Å
SCOPe Domain Sequences for d1ovmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovmd2 c.36.1.5 (D:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
Timeline for d1ovmd2: