SCOPe 2.01: Domain d1ov3b1: 1ov3 B:152-214

Lineage for d1ov3b1 (1ov3 B:152-214)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)

8. Domain d1ov3b1: 1ov3 B:152-214 [87453]
   N-terminal domain forms a segment-swapped dimer; C-terminal domain binds a peptide from p22phox, chains C and D

Details for d1ov3b1

PDB Entry: 1ov3, 1.8 Å

PDB Description: structure of the p22phox-p47phox complex

PDB Compounds: (B:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1ov3b1:

Sequence; same for both SEQRES and ATOM records:

>d1ov3b1 b.34.2.1 (B:152-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
spefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasfle
pld

Timeline for d1ov3b1:

• d1ov3b1 first appeared in SCOP 1.65
  
• d1ov3b1 appears in SCOP 1.75
  
• d1ov3b1 appears in SCOPe 2.02
  
• d1ov3b1 appears in the current release, SCOPe 2.08