PDB entry 1ov3

View 1ov3 on RCSB PDB site
Description: Structure of the p22phox-p47phox complex
Class: Oxidoreductase activator
Keywords: p47phox, p22phox, NADPH oxidase, complex, Oxidoreductase activator
Deposited on 2003-03-25, released 2003-05-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14598 (8-End)
      • gst tag (2-7)
    Domains in SCOPe 2.01: d1ov3a1, d1ov3a2
  • Chain 'B':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14598 (8-End)
      • gst tag (4-7)
    Domains in SCOPe 2.01: d1ov3b1, d1ov3b2
  • Chain 'C':
    Compound: Flavocytochrome b558 alpha polypeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_000092
  • Chain 'D':
    Compound: Flavocytochrome b558 alpha polypeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_000092
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ov3A (A:)
    gplgspefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipa
    sflepldspdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvir
    kddvtgyfpsmylqksgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ov3A (A:)
    lgspefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasf
    lepldspdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvirkd
    dvtgyfpsmylqks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ov3B (B:)
    gplgspefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipa
    sflepldspdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvir
    kddvtgyfpsmylqksgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ov3B (B:)
    spefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasfle
    pldspdepnyagepyvaikaytavegdevsllegeavevihklldgwwvirkddvtgyfp
    smylqks
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.