Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
Protein Potassium channel KVAP [90107] (1 species) |
Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries) |
Domain d1orsc_: 1ors C: [87353] Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb1, d1orsb2 perimeter subdomain only |
PDB Entry: 1ors (more details), 1.9 Å
SCOP Domain Sequences for d1orsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls aiadaadklvpr
Timeline for d1orsc_:
View in 3D Domains from other chains: (mouse over for more information) d1orsa1, d1orsa2, d1orsb1, d1orsb2 |