Lineage for d1orsc1 (1ors C:20-148)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577077Protein Potassium channel KVAP [90107] (1 species)
  7. 2577078Species Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries)
  8. 2577079Domain d1orsc1: 1ors C:20-148 [87353]
    Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb1, d1orsb2, d1orsc2
    perimeter subdomain only

Details for d1orsc1

PDB Entry: 1ors (more details), 1.9 Å

PDB Description: X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab
PDB Compounds: (C:) potassium channel

SCOPe Domain Sequences for d1orsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orsc1 f.14.1.1 (C:20-148) Potassium channel KVAP {Aeropyrum pernix [TaxId: 56636]}
dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk
sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls
aiadaadkl

SCOPe Domain Coordinates for d1orsc1:

Click to download the PDB-style file with coordinates for d1orsc1.
(The format of our PDB-style files is described here.)

Timeline for d1orsc1: