![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel KVAP [90107] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries) |
![]() | Domain d1orsc1: 1ors C:20-148 [87353] Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb1, d1orsb2, d1orsc2 perimeter subdomain only has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ors (more details), 1.9 Å
SCOPe Domain Sequences for d1orsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orsc1 f.14.1.1 (C:20-148) Potassium channel KVAP {Aeropyrum pernix [TaxId: 56636]} dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls aiadaadkl
Timeline for d1orsc1:
![]() Domains from other chains: (mouse over for more information) d1orsa1, d1orsa2, d1orsb1, d1orsb2 |