PDB entry 1ors

View 1ors on RCSB PDB site
Description: X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab
Class: membrane protein
Keywords: potassium channel, voltage-dependent, voltage sensor, KvAP, Fab complex
Deposited on 2003-03-14, released 2003-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 33H1 Fab light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1orsa1, d1orsa2
  • Chain 'B':
    Compound: 33H1 Fab heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1orsb1, d1orsb2
  • Chain 'C':
    Compound: potassium channel
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YDF8 (0-128)
      • engineered (128)
      • cloning artifact (129-131)
    Domains in SCOP 1.75: d1orsc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsA (A:)
    qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsB (B:)
    dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
    npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsC (C:)
    dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk
    sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls
    aiadaadklvpr