Lineage for d1oqcc_ (1oqc C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700461Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2700462Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 2700463Protein Augmenter of liver regeneration [89018] (2 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 2700474Species Norway rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry)
  8. 2700477Domain d1oqcc_: 1oqc C: [87266]
    complexed with fad

Details for d1oqcc_

PDB Entry: 1oqc (more details), 1.8 Å

PDB Description: The crystal structure of augmenter of liver regeneration: a mammalian FAD dependent sulfhydryl oxidase
PDB Compounds: (C:) Augmenter of liver regeneration

SCOPe Domain Sequences for d1oqcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqcc_ a.24.15.1 (C:) Augmenter of liver regeneration {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkr
idrsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

SCOPe Domain Coordinates for d1oqcc_:

Click to download the PDB-style file with coordinates for d1oqcc_.
(The format of our PDB-style files is described here.)

Timeline for d1oqcc_: