Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Swine vesicular disease virus coat proteins [89225] (1 species) |
Species Swine vesicular disease virus [TaxId:12075] [89226] (2 PDB entries) |
Domain d1oop.1: 1oop D:,B: [87203] complexed with myr, sph |
PDB Entry: 1oop (more details), 3 Å
SCOPe Domain Sequences for d1oop.1:
Sequence, based on SEQRES records: (download)
>g1oop.1 b.121.4.1 (D:,B:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]} gaqvstqktgahetslsaagnsvihytninyykdaasnsanrqdftqdpgkftepvkdim vksmpalnXsdrvrsitlgnstittqecanvvvgygvwptylkdeeataedqptqpdvat crfytlesvmwqqsspgwwwkfpdalsnmglfgqnmqyhylgragytihvqcnaskfhqg cllvvcvpeaemgcatlankpdpkslskgeianmfesqnstgetavqanvinagmgvgvg nltifphqwinlrtnnsativmpyinsvpmdnmfrhnnftlmvipfaplsystgattyvp itvtvapmcaeynglrlagkq
>g1oop.1 b.121.4.1 (D:,B:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]} gaqvstqktgaheihytninyykdaasnsanrqdftqdpgkftepvkdimvksmpalnXs drvrsitlgnstittqecanvvvgygvwptylkdeeataedqptqpdvatcrfytlesvm wqqsspgwwwkfpdalsnmglfgqnmqyhylgragytihvqcnaskfhqgcllvvcvpea emgcatlankpdpkslskgeianmfesqnstgetavqanvinagmgvgvgnltifphqwi nlrtnnsativmpyinsvpmdnmfrhnnftlmvipfaplsystgattyvpitvtvapmca eynglrlagkq
Timeline for d1oop.1:
View in 3D Domains from other chains: (mouse over for more information) d1oopa_, d1oopa_, d1oopc_, d1oopc_ |