SCOPe 2.07: Domain d1oop.1: 1oop D:,B:

Lineage for d1oop.1 (1oop D:,B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Swine vesicular disease virus coat proteins [89225] (1 species)

7. Species Swine vesicular disease virus [TaxId:12075] [89226] (2 PDB entries)

8. Domain d1oop.1: 1oop D:,B: [87203]
   complexed with myr, sph

Details for d1oop.1

PDB Entry: 1oop, 3 Å

PDB Description: the crystal structure of swine vesicular disease virus

PDB Compounds: (B:) coat protein vp2, (D:) coat protein vp4

SCOPe Domain Sequences for d1oop.1:

Sequence, based on SEQRES records:

>g1oop.1 b.121.4.1 (D:,B:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]}
gaqvstqktgahetslsaagnsvihytninyykdaasnsanrqdftqdpgkftepvkdim
vksmpalnXsdrvrsitlgnstittqecanvvvgygvwptylkdeeataedqptqpdvat
crfytlesvmwqqsspgwwwkfpdalsnmglfgqnmqyhylgragytihvqcnaskfhqg
cllvvcvpeaemgcatlankpdpkslskgeianmfesqnstgetavqanvinagmgvgvg
nltifphqwinlrtnnsativmpyinsvpmdnmfrhnnftlmvipfaplsystgattyvp
itvtvapmcaeynglrlagkq

Sequence, based on observed residues (ATOM records):

>g1oop.1 b.121.4.1 (D:,B:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]}
gaqvstqktgaheihytninyykdaasnsanrqdftqdpgkftepvkdimvksmpalnXs
drvrsitlgnstittqecanvvvgygvwptylkdeeataedqptqpdvatcrfytlesvm
wqqsspgwwwkfpdalsnmglfgqnmqyhylgragytihvqcnaskfhqgcllvvcvpea
emgcatlankpdpkslskgeianmfesqnstgetavqanvinagmgvgvgnltifphqwi
nlrtnnsativmpyinsvpmdnmfrhnnftlmvipfaplsystgattyvpitvtvapmca
eynglrlagkq

Timeline for d1oop.1:

• d1oop.1 first appeared in SCOP 1.65
  
• d1oop.1 appears in SCOPe 2.06
  
• d1oop.1 appears in the current release, SCOPe 2.08