SCOPe 2.02: Domain d1ook.1: 1ook A:,B:

Lineage for d1ook.1 (1ook A:,B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (160 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1ook.1: 1ook A:,B: [87199]
   Other proteins in same PDB: d1ookg_
   complexed with cl, nag

Details for d1ook.1

PDB Entry: 1ook, 2.3 Å

PDB Description: crystal structure of the complex of platelet receptor gpib-alpha and human alpha-thrombin

PDB Compounds: (A:) human alpha thrombin, (B:) human alpha thrombin

SCOPe Domain Sequences for d1ook.1:

Sequence; same for both SEQRES and ATOM records:

>g1ook.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Timeline for d1ook.1:

• d1ook.1 first appeared in SCOP 1.65
  
• d1ook.1 appears in SCOPe 2.01
  
• d1ook.1 appears in SCOPe 2.03
  
• d1ook.1 appears in the current release, SCOPe 2.08