Lineage for d1onnb2 (1onn B:1-125,B:275-300)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687228Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 687229Species Escherichia coli [TaxId:562] [69411] (11 PDB entries)
  8. 687249Domain d1onnb2: 1onn B:1-125,B:275-300 [87157]
    Other proteins in same PDB: d1onna1, d1onna3, d1onnb1, d1onnb3

Details for d1onnb2

PDB Entry: 1onn (more details), 2.6 Å

PDB Description: IspC apo structure
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOP Domain Sequences for d1onnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onnb2 c.2.1.3 (B:1-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOP Domain Coordinates for d1onnb2:

Click to download the PDB-style file with coordinates for d1onnb2.
(The format of our PDB-style files is described here.)

Timeline for d1onnb2: