Lineage for d1onie_ (1oni E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958621Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species)
    mammalian tumor associated antigen UK114
  7. 2958629Species Human (Homo sapiens) [TaxId:9606] [89980] (1 PDB entry)
  8. 2958634Domain d1onie_: 1oni E: [87148]
    complexed with bez

Details for d1onie_

PDB Entry: 1oni (more details), 1.9 Å

PDB Description: crystal structure of a human p14.5, a translational inhibitor reveals different mode of ligand binding near the invariant residues of the yjgf/uk114 protein family
PDB Compounds: (E:) 14.5 kDa translational inhibitor protein

SCOPe Domain Sequences for d1onie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onie_ d.79.1.1 (E:) 14.5 kda translational inhibitor protein, L-PSP {Human (Homo sapiens) [TaxId: 9606]}
sslirrvistakapgaigpysqavlvdrtiyisgqigmdpssgqlvsggvaeeakqalkn
mgeilkaagcdftnvvkttvlladindfntvneiykqyfksnfparaayqvaalpkgsri
eieavaiqgpltta

SCOPe Domain Coordinates for d1onie_:

Click to download the PDB-style file with coordinates for d1onie_.
(The format of our PDB-style files is described here.)

Timeline for d1onie_: