Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (4 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89980] (1 PDB entry) |
Domain d1onie_: 1oni E: [87148] |
PDB Entry: 1oni (more details), 1.9 Å
SCOP Domain Sequences for d1onie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onie_ d.79.1.1 (E:) 14.5 kda translational inhibitor protein, L-PSP {Human (Homo sapiens)} sslirrvistakapgaigpysqavlvdrtiyisgqigmdpssgqlvsggvaeeakqalkn mgeilkaagcdftnvvkttvlladindfntvneiykqyfksnfparaayqvaalpkgsri eieavaiqgpltta
Timeline for d1onie_: