Lineage for d1omwa2 (1omw A:550-668)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [89354] (6 PDB entries)
  8. Domain d1omwa2: 1omw A:550-668 [87087]
    Other proteins in same PDB: d1omwa1, d1omwa3, d1omwb_, d1omwg_

Details for d1omwa2

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits
PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d1omwa2:

Sequence, based on SEQRES records: (download)

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Sequence, based on observed residues (ATOM records): (download)

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgwqrryfylfpnrlewrgegeapqslltmeeiqsveetqik
erkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOPe Domain Coordinates for d1omwa2 are not available.

Timeline for d1omwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1omwa1, d1omwa3
View in 3D
Domains from other chains:
(mouse over for more information)
d1omwb_, d1omwg_