Lineage for d1omwg_ (1omw G:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [48673] (59 PDB entries)
  8. Domain d1omwg_: 1omw G: [87090]
    Other proteins in same PDB: d1omwa1, d1omwa2, d1omwa3, d1omwb_

Details for d1omwg_

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOPe Domain Sequences for d1omwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omwg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

SCOPe Domain Coordinates for d1omwg_ are not available.

Timeline for d1omwg_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1omwa1, d1omwa2, d1omwa3, d1omwb_