Lineage for d1okea2 (1oke A:1-297)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058659Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1058660Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 1058661Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 1058662Protein Envelope glycoprotein [56985] (2 species)
  7. 1058663Species Dengue virus type 2 [TaxId:11060] [90131] (7 PDB entries)
    Uniprot P12823 281-675
  8. 1058668Domain d1okea2: 1oke A:1-297 [87055]
    Other proteins in same PDB: d1okea1, d1okeb1
    complexed with bog, nag

Details for d1okea2

PDB Entry: 1oke (more details), 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside
PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1okea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okea2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d1okea2:

Click to download the PDB-style file with coordinates for d1okea2.
(The format of our PDB-style files is described here.)

Timeline for d1okea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okea1