| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) ![]() |
| Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins) |
| Protein Envelope glycoprotein [56985] (2 species) |
| Species Dengue virus type 2 [TaxId:11060] [90131] (7 PDB entries) Uniprot P12823 281-675 |
| Domain d1okea2: 1oke A:1-297 [87055] Other proteins in same PDB: d1okea1, d1okeb1 complexed with bog, nag |
PDB Entry: 1oke (more details), 2.4 Å
SCOPe Domain Sequences for d1okea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okea2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d1okea2: