SCOP 1.75: Domain d1okea2: 1oke A:1-297

Lineage for d1okea2 (1oke A:1-297)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)

6. Protein Envelope glycoprotein [56985] (2 species)

7. Species Dengue virus type 2 [TaxId:11060] [90131] (7 PDB entries)
   Uniprot P12823 281-675

8. Domain d1okea2: 1oke A:1-297 [87055]
   Other proteins in same PDB: d1okea1, d1okeb1

Details for d1okea2

PDB Entry: 1oke, 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside

PDB Compounds: (A:) major envelope protein E

SCOP Domain Sequences for d1okea2:

Sequence; same for both SEQRES and ATOM records:

>d1okea2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Timeline for d1okea2:

• d1okea2 first appeared in SCOP 1.65
  
• d1okea2 appears in SCOP 1.73
  
• d1okea2 appears in SCOPe 2.01
  
• d1okea2 appears in the current release, SCOPe 2.08