Lineage for d1okeb1 (1oke B:298-394)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789318Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 789319Protein Envelope glycoprotein [49213] (5 species)
  7. 789320Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 789323Domain d1okeb1: 1oke B:298-394 [87056]
    Other proteins in same PDB: d1okea2, d1okeb2
    complexed with afl, bma, bog, nag

Details for d1okeb1

PDB Entry: 1oke (more details), 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside
PDB Compounds: (B:) major envelope protein E

SCOP Domain Sequences for d1okeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okeb1 b.1.18.4 (B:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOP Domain Coordinates for d1okeb1:

Click to download the PDB-style file with coordinates for d1okeb1.
(The format of our PDB-style files is described here.)

Timeline for d1okeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okeb2