SCOPe 2.02: Domain d1okea1: 1oke A:298-394

Lineage for d1okea1 (1oke A:298-394)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d1okea1: 1oke A:298-394 [87054]
   Other proteins in same PDB: d1okea2, d1okeb2
   complexed with bog, nag

Details for d1okea1

PDB Entry: 1oke, 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside

PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1okea1:

Sequence; same for both SEQRES and ATOM records:

>d1okea1 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d1okea1:

• d1okea1 first appeared in SCOP 1.65
  
• d1okea1 appears in SCOPe 2.01
  
• d1okea1 appears in SCOPe 2.03
  
• d1okea1 appears in the current release, SCOPe 2.08