Lineage for d1okea1 (1oke A:298-394)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291696Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 protein domains)
  6. 291697Protein Envelope glycoprotein [49213] (2 species)
  7. 291698Species Dengue virus type 2 [TaxId:12637] [89194] (2 PDB entries)
  8. 291699Domain d1okea1: 1oke A:298-394 [87054]
    Other proteins in same PDB: d1okea2, d1okeb2

Details for d1okea1

PDB Entry: 1oke (more details), 2.4 Å

PDB Description: Crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-D-glucoside

SCOP Domain Sequences for d1okea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okea1 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOP Domain Coordinates for d1okea1:

Click to download the PDB-style file with coordinates for d1okea1.
(The format of our PDB-style files is described here.)

Timeline for d1okea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okea2