Lineage for d1ohhb1 (1ohh B:380-510)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717311Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2717330Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2717365Domain d1ohhb1: 1ohh B:380-510 [87018]
    Other proteins in same PDB: d1ohha2, d1ohha3, d1ohhb2, d1ohhb3, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_
    complexed with anp, mg

Details for d1ohhb1

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
PDB Compounds: (B:) ATP synthase alpha chain heart isoform, mitochondrial

SCOPe Domain Sequences for d1ohhb1:

Sequence, based on SEQRES records: (download)

>d1ohhb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d1ohhb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnflag
fea

SCOPe Domain Coordinates for d1ohhb1:

Click to download the PDB-style file with coordinates for d1ohhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ohhb1: