SCOPe 2.08: Domain d1ohhg_: 1ohh G:

Lineage for d1ohhg_ (1ohh G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
   automatically mapped to Pfam PF00231

6. Protein F1 ATP synthase gamma subunit [52945] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
   Uniprot P05631

8. Domain d1ohhg_: 1ohh G: [87033]
   Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhh_
   core domain is disordered; only coiled coil part is visible
   complexed with anp, mg
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1ohhg_

PDB Entry: 1ohh, 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

PDB Compounds: (G:) ATP synthase gamma chain, mitochondrial

SCOPe Domain Sequences for d1ohhg_:

Sequence, based on SEQRES records:

>d1ohhg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records):

>d1ohhg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaaklcgaihssvakqttseqsarmtamdnaskn
asemidkltltfnrtrqavitkelieiisgaaal

Timeline for d1ohhg_:

• d1ohhg_ first appeared in SCOP 1.65
  
• d1ohhg_ appears in SCOPe 2.07