Lineage for d1ofta_ (1oft A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871472Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein)
    homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423
  6. 2871473Protein Hypothetical protein PA3008 [89679] (1 species)
  7. 2871474Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries)
  8. 2871477Domain d1ofta_: 1oft A: [86968]

Details for d1ofta_

PDB Entry: 1oft (more details), 2.9 Å

PDB Description: crystal structure of sula from pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein pa3008

SCOPe Domain Sequences for d1ofta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofta_ c.37.1.22 (A:) Hypothetical protein PA3008 {Pseudomonas aeruginosa [TaxId: 287]}
paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg

SCOPe Domain Coordinates for d1ofta_:

Click to download the PDB-style file with coordinates for d1ofta_.
(The format of our PDB-style files is described here.)

Timeline for d1ofta_: