Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein) homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423 |
Protein Hypothetical protein PA3008 [89679] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries) |
Domain d1ofta_: 1oft A: [86968] |
PDB Entry: 1oft (more details), 2.9 Å
SCOP Domain Sequences for d1ofta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofta_ c.37.1.22 (A:) Hypothetical protein PA3008 {Pseudomonas aeruginosa} paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg
Timeline for d1ofta_: