Lineage for d1odga_ (1odg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136431Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein)
  6. 2136432Protein Very short patch repair (VSR) endonuclease [53024] (1 species)
  7. 2136433Species Escherichia coli [TaxId:562] [53025] (3 PDB entries)
  8. 2136436Domain d1odga_: 1odg A: [86849]
    bound to the reaction product site
    complexed with zn

Details for d1odga_

PDB Entry: 1odg (more details), 2.8 Å

PDB Description: very-short-patch dna repair endonuclease bound to its reaction product site
PDB Compounds: (A:) DNA mismatch endonuclease

SCOPe Domain Sequences for d1odga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odga_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli [TaxId: 562]}
aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr
tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg
asaqidtqgihlla

SCOPe Domain Coordinates for d1odga_:

Click to download the PDB-style file with coordinates for d1odga_.
(The format of our PDB-style files is described here.)

Timeline for d1odga_: