PDB entry 1odg

View 1odg on RCSB PDB site
Description: very-short-patch DNA repair endonuclease bound to its reaction product site
Class: hydrolase
Keywords: hydrolase, DNA repair, endonuclease, very short patch repair, DNA repai hydrolase, nuclease, zinc, metal-binding
Deposited on 2003-02-19, released 2003-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2873
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA mismatch endonuclease
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09184 (0-133)
  Domains in SCOPe 2.06: d1odga_
• Chain 'F':
  Compound: 5'-d(*tp*ap*gp*gp*cp*5cm*tp*gp*gp*ap*tp*cp)-3'
  Species: Escherichia coli [TaxId:562]
  
• Chain 'W':
  Compound: 5'-d(*tp*ap*gp*gp*cp*5cm*tp*gp*gp*ap*tp*cp)-3'
  Species: Escherichia coli [TaxId:562]
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1odgA (A:)
  aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr
  tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg
  asaqidtqgihlla
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.