Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.2: Chorismate mutase [55304] (1 protein) automatically mapped to Pfam PF07736 |
Protein Chorismate mutase [55305] (3 species) |
Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries) |
Domain d1odec_: 1ode C: [86848] |
PDB Entry: 1ode (more details), 1.65 Å
SCOPe Domain Sequences for d1odec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1odec_ d.79.1.2 (C:) Chorismate mutase {Thermus thermophilus [TaxId: 274]} mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp
Timeline for d1odec_: