Lineage for d1odec_ (1ode C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330739Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 330740Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 330775Family d.79.1.2: Chorismate mutase [55304] (1 protein)
  6. 330776Protein Chorismate mutase [55305] (2 species)
  7. 330819Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries)
  8. 330824Domain d1odec_: 1ode C: [86848]
    mutant

Details for d1odec_

PDB Entry: 1ode (more details), 1.65 Å

PDB Description: crystal analysis of chorismate mutase from thermus thermophilus.

SCOP Domain Sequences for d1odec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odec_ d.79.1.2 (C:) Chorismate mutase {Thermus thermophilus}
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp

SCOP Domain Coordinates for d1odec_:

Click to download the PDB-style file with coordinates for d1odec_.
(The format of our PDB-style files is described here.)

Timeline for d1odec_: