SCOPe 2.01: Domain d1odbd_: 1odb D:

Lineage for d1odbd_ (1odb D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)

8. Domain d1odbd_: 1odb D: [86843]
   complexed with ca, cu

Details for d1odbd_

PDB Entry: 1odb, 2.19 Å

PDB Description: the crystal structure of human s100a12 - copper complex

PDB Compounds: (D:) calgranulin c

SCOPe Domain Sequences for d1odbd_:

Sequence; same for both SEQRES and ATOM records:

>d1odbd_ a.39.1.2 (D:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthk

Timeline for d1odbd_:

• d1odbd_ first appeared in SCOP 1.65
  
• d1odbd_ appears in SCOP 1.75
  
• d1odbd_ appears in SCOPe 2.02
  
• d1odbd_ appears in the current release, SCOPe 2.08, called d1odbd1