Lineage for d1od4b1 (1od4 B:1480-1814)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 981203Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 981204Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 981205Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (7 PDB entries)
    Uniprot Q00955 1482-2196
  8. 981230Domain d1od4b1: 1od4 B:1480-1814 [86828]
    complexed with ade

Details for d1od4b1

PDB Entry: 1od4 (more details), 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain
PDB Compounds: (B:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1od4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od4b1 c.14.1.4 (B:1480-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d1od4b1:

Click to download the PDB-style file with coordinates for d1od4b1.
(The format of our PDB-style files is described here.)

Timeline for d1od4b1: