Lineage for d1ocya_ (1ocy A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614149Fold d.231: Receptor-binding domain of short tail fibre protein gp12 [88873] (1 superfamily)
    unusual fold; trimer
  4. 2614150Superfamily d.231.1: Receptor-binding domain of short tail fibre protein gp12 [88874] (1 family) (S)
  5. 2614151Family d.231.1.1: Receptor-binding domain of short tail fibre protein gp12 [88875] (1 protein)
  6. 2614152Protein Receptor-binding domain of short tail fibre protein gp12 [88876] (1 species)
    intertwinned homotrimer; subdivided into the neck, collar, head and bonnet regions
  7. 2614153Species Bacteriophage T4 [TaxId:10665] [88877] (2 PDB entries)
  8. 2614154Domain d1ocya_: 1ocy A: [86817]
    complexed with cit, so4, zn

Details for d1ocya_

PDB Entry: 1ocy (more details), 1.5 Å

PDB Description: structure of the receptor-binding domain of the bacteriophage t4 short tail fibre
PDB Compounds: (A:) bacteriophage t4 short tail fibre

SCOPe Domain Sequences for d1ocya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocya_ d.231.1.1 (A:) Receptor-binding domain of short tail fibre protein gp12 {Bacteriophage T4 [TaxId: 10665]}
rvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryggsssn
pglpdmrglfvrgsgrgshltnpnvngndqfgkprlgvgctggyvgevqkqqmsyhkhag
gfgeyddsgafgntrrsnfvgtrkgldwdnrsyftndgyeidpasqrnsrytlnrpelig
netrpwnislnyiikvke

SCOPe Domain Coordinates for d1ocya_:

Click to download the PDB-style file with coordinates for d1ocya_.
(The format of our PDB-style files is described here.)

Timeline for d1ocya_: