Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.231: Receptor-binding domain of short tail fibre protein gp12 [88873] (1 superfamily) unusual fold; trimer |
Superfamily d.231.1: Receptor-binding domain of short tail fibre protein gp12 [88874] (1 family) |
Family d.231.1.1: Receptor-binding domain of short tail fibre protein gp12 [88875] (1 protein) |
Protein Receptor-binding domain of short tail fibre protein gp12 [88876] (1 species) intertwinned homotrimer; subdivided into the neck, collar, head and bonnet regions |
Species Bacteriophage T4 [TaxId:10665] [88877] (2 PDB entries) |
Domain d1ocya_: 1ocy A: [86817] complexed with cit, so4, zn |
PDB Entry: 1ocy (more details), 1.5 Å
SCOPe Domain Sequences for d1ocya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocya_ d.231.1.1 (A:) Receptor-binding domain of short tail fibre protein gp12 {Bacteriophage T4 [TaxId: 10665]} rvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryggsssn pglpdmrglfvrgsgrgshltnpnvngndqfgkprlgvgctggyvgevqkqqmsyhkhag gfgeyddsgafgntrrsnfvgtrkgldwdnrsyftndgyeidpasqrnsrytlnrpelig netrpwnislnyiikvke
Timeline for d1ocya_: