PDB entry 1ocy

View 1ocy on RCSB PDB site
Description: Structure of the receptor-binding domain of the bacteriophage T4 short tail fibre
Class: structural protein
Keywords: structural protein, fibrous protein, lipo-polysaccharide binding, bacteriophage structural protein, baseplate protein, gene product 12
Deposited on 2003-02-11, released 2003-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bacteriophage t4 short tail fibre
  Species: Bacteriophage T4 [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q38160 (0-197)
    • conflict (56)
  Domains in SCOPe 2.08: d1ocya_
• Heterogens: CIT, SO4, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ocyA (A:)
  rvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryggsssn
  pglpdmrglfvrgsgrgshltnpnvngndqfgkprlgvgctggyvgevqkqqmsyhkhag
  gfgeyddsgafgntrrsnfvgtrkgldwdnrsyftndgyeidpasqrnsrytlnrpelig
  netrpwnislnyiikvke