Lineage for d1ocba_ (1ocb A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110412Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2110413Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2110414Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2110415Species Humicola insolens, Cel6a [TaxId:34413] [51995] (9 PDB entries)
  8. 2110420Domain d1ocba_: 1ocb A: [86799]
    complexed with flg, gda, gol, gtm, nag

Details for d1ocba_

PDB Entry: 1ocb (more details), 1.75 Å

PDB Description: structure of the wild-type cellobiohydrolase cel6a from humicolas insolens in complex with a fluorescent substrate
PDB Compounds: (A:) cellobiohydrolase II

SCOPe Domain Sequences for d1ocba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocba_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]}
ngnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllv
qtlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrire
ilisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymda
ghagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpny
dekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantgh
qyvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanpp
f

SCOPe Domain Coordinates for d1ocba_:

Click to download the PDB-style file with coordinates for d1ocba_.
(The format of our PDB-style files is described here.)

Timeline for d1ocba_: