SCOPe 2.05: Domain d1ocba_: 1ocb A:

Lineage for d1ocba_ (1ocb A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
   Pfam PF01341

6. Protein Cellobiohydrolase II (Cel6) [51993] (3 species)

7. Species Humicola insolens, Cel6a [TaxId:34413] [51995] (9 PDB entries)

8. Domain d1ocba_: 1ocb A: [86799]
   complexed with flg, gda, gol, gtm, nag

Details for d1ocba_

PDB Entry: 1ocb, 1.75 Å

PDB Description: structure of the wild-type cellobiohydrolase cel6a from humicolas insolens in complex with a fluorescent substrate

PDB Compounds: (A:) cellobiohydrolase II

SCOPe Domain Sequences for d1ocba_:

Sequence; same for both SEQRES and ATOM records:

>d1ocba_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]}
ngnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllv
qtlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrire
ilisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymda
ghagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpny
dekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantgh
qyvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanpp
f

Timeline for d1ocba_:

• d1ocba_ first appeared in SCOP 1.65
  
• d1ocba_ appears in SCOPe 2.04
  
• d1ocba_ appears in SCOPe 2.06
  
• d1ocba_ appears in the current release, SCOPe 2.08