Lineage for d1oanb2 (1oan B:1-297)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058659Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1058660Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 1058661Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 1058662Protein Envelope glycoprotein [56985] (2 species)
  7. 1058663Species Dengue virus type 2 [TaxId:11060] [90131] (7 PDB entries)
    Uniprot P12823 281-675
  8. 1058667Domain d1oanb2: 1oan B:1-297 [86743]
    Other proteins in same PDB: d1oana1, d1oanb1
    complexed with na, nag

Details for d1oanb2

PDB Entry: 1oan (more details), 2.75 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein
PDB Compounds: (B:) Envelope glycoprotein

SCOPe Domain Sequences for d1oanb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oanb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d1oanb2:

Click to download the PDB-style file with coordinates for d1oanb2.
(The format of our PDB-style files is described here.)

Timeline for d1oanb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oanb1