Lineage for d1oanb1 (1oan B:298-394)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937854Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 937855Protein Envelope glycoprotein [49213] (5 species)
  7. 937856Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 937860Domain d1oanb1: 1oan B:298-394 [86742]
    Other proteins in same PDB: d1oana2, d1oanb2
    complexed with na, nag

Details for d1oanb1

PDB Entry: 1oan (more details), 2.75 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein
PDB Compounds: (B:) Envelope glycoprotein

SCOPe Domain Sequences for d1oanb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oanb1 b.1.18.4 (B:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d1oanb1:

Click to download the PDB-style file with coordinates for d1oanb1.
(The format of our PDB-style files is described here.)

Timeline for d1oanb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oanb2