SCOPe 2.06: Domain d1o9aa2: 1o9a A:61-109

Lineage for d1o9aa2 (1o9a A:61-109)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d1o9aa2: 1o9a A:61-109 [86687]
   1st and 2nd modules in complex with a peptide from the streptococcal fibronectin binding protein, FnbB, chain B

Details for d1o9aa2

PDB Entry: 1o9a

PDB Description: solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1o9aa2:

Sequence; same for both SEQRES and ATOM records:

>d1o9aa2 g.27.1.1 (A:61-109) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
eaeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianr

Timeline for d1o9aa2:

• d1o9aa2 first appeared in SCOP 1.65
  
• d1o9aa2 appears in SCOPe 2.05
  
• d1o9aa2 appears in SCOPe 2.07
  
• d1o9aa2 appears in the current release, SCOPe 2.08