SCOP 1.65: Domain d1o9aa2: 1o9a A:61-109

Lineage for d1o9aa2 (1o9a A:61-109)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)
   disulphide-rich, all-beta

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (6 PDB entries)

8. Domain d1o9aa2: 1o9a A:61-109 [86687]
   1st and 2nd modules in complex with a peptide from the streptococcal fibronectin binding protein, FnbB, chain B

Details for d1o9aa2

PDB Entry: 1o9a

PDB Description: solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae

SCOP Domain Sequences for d1o9aa2:

Sequence; same for both SEQRES and ATOM records:

>d1o9aa2 g.27.1.1 (A:61-109) Fibronectin {Human (Homo sapiens)}
eaeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianr

Timeline for d1o9aa2:

• d1o9aa2 is new in SCOP 1.65
  
• d1o9aa2 appears in SCOP 1.67
  
• d1o9aa2 appears in the current release, SCOPe 2.08