SCOP 1.65: Domain d1o9aa1: 1o9a A:17-60

Lineage for d1o9aa1 (1o9a A:17-60)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)
   disulphide-rich, all-beta

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (6 PDB entries)

8. Domain d1o9aa1: 1o9a A:17-60 [86686]

Details for d1o9aa1

PDB Entry: 1o9a

PDB Description: solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae

SCOP Domain Sequences for d1o9aa1:

Sequence; same for both SEQRES and ATOM records:

>d1o9aa1 g.27.1.1 (A:17-60) Fibronectin {Human (Homo sapiens)}
skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskp

Timeline for d1o9aa1:

• d1o9aa1 is new in SCOP 1.65
  
• d1o9aa1 appears in SCOP 1.67
  
• d1o9aa1 appears in the current release, SCOPe 2.08