SCOPe 2.07: Domain d1o26b1: 1o26 B:1-220

Lineage for d1o26b1 (1o26 B:1-220)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein Thy1 homologue [69798] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69799] (28 PDB entries)
   TM0449

8. Domain d1o26b1: 1o26 B:1-220 [86567]
   Other proteins in same PDB: d1o26a2, d1o26b2
   structural genomics
   complexed with fad, pge, ump

Details for d1o26b1

PDB Entry: 1o26, 1.6 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution

PDB Compounds: (B:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o26b1:

Sequence; same for both SEQRES and ATOM records:

>d1o26b1 d.207.1.1 (B:1-220) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Timeline for d1o26b1:

• d1o26b1 first appeared in SCOP 1.65, called d1o26b_
  
• d1o26b1 appears in SCOPe 2.06
  
• d1o26b1 appears in the current release, SCOPe 2.08