Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) automatically mapped to Pfam PF02511 |
Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
Protein Thy1 homologue [69798] (1 species) |
Species Thermotoga maritima [TaxId:2336] [69799] (28 PDB entries) TM0449 |
Domain d1o26b1: 1o26 B:1-220 [86567] Other proteins in same PDB: d1o26a2, d1o26b2 structural genomics complexed with fad, pge, ump |
PDB Entry: 1o26 (more details), 1.6 Å
SCOPe Domain Sequences for d1o26b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o26b1 d.207.1.1 (B:1-220) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
Timeline for d1o26b1:
View in 3D Domains from other chains: (mouse over for more information) d1o26a1, d1o26a2, d1o26c_, d1o26d_ |