SCOP 1.65: Domain d1o26b_: 1o26 B:

Lineage for d1o26b_ (1o26 B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family)

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (1 protein)

6. Protein Thy1 homologue [69798] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [69799] (9 PDB entries)
   TM0449

8. Domain d1o26b_: 1o26 B: [86567]

Details for d1o26b_

PDB Entry: 1o26, 1.6 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution

SCOP Domain Sequences for d1o26b_:

Sequence; same for both SEQRES and ATOM records:

>d1o26b_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima}
hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
ivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervt
ekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsha
qweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Timeline for d1o26b_:

• d1o26b_ is new in SCOP 1.65
  
• d1o26b_ appears in SCOP 1.67
  
• d1o26b_ appears in the current release, SCOPe 2.08, called d1o26b1