SCOPe 2.04: Domain d1o1ya_: 1o1y A:

Lineage for d1o1ya_ (1o1y A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Hypothetical protein TM1158 [89599] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89600] (1 PDB entry)

8. Domain d1o1ya_: 1o1y A: [86554]
   structural genomics
   complexed with so4

Details for d1o1ya_

PDB Entry: 1o1y, 1.7 Å

PDB Description: crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution

PDB Compounds: (A:) conserved hypothetical protein TM1158

SCOPe Domain Sequences for d1o1ya_:

Sequence; same for both SEQRES and ATOM records:

>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]}
hhhvrvlairhveiedlgmmedifreknwsfdyldtpkgeklerpleeyslvvllggymg
ayeeekypflkyefqlieeilkkeipflgiclgsqmlakvlgasvyrgkngeeigwyfve
kvsdnkffrefpdrlrvfqwhgdtfdlprratrvftsekyenqgfvygkavglqfhievg
artmkrwieaykdelekkkidprllletaereekvlkgllrsllermves

Timeline for d1o1ya_:

• d1o1ya_ first appeared in SCOP 1.65
  
• d1o1ya_ appears in SCOPe 2.03
  
• d1o1ya_ appears in SCOPe 2.05
  
• d1o1ya_ appears in the current release, SCOPe 2.08, called d1o1ya1