| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein Hypothetical protein TM1158 [89599] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [89600] (1 PDB entry) |
| Domain d1o1ya_: 1o1y A: [86554] structural genomics complexed with so4 |
PDB Entry: 1o1y (more details), 1.7 Å
SCOPe Domain Sequences for d1o1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]}
hhhvrvlairhveiedlgmmedifreknwsfdyldtpkgeklerpleeyslvvllggymg
ayeeekypflkyefqlieeilkkeipflgiclgsqmlakvlgasvyrgkngeeigwyfve
kvsdnkffrefpdrlrvfqwhgdtfdlprratrvftsekyenqgfvygkavglqfhievg
artmkrwieaykdelekkkidprllletaereekvlkgllrsllermves
Timeline for d1o1ya_: