Lineage for d1o1ya_ (1o1y A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358418Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1358532Protein Hypothetical protein TM1158 [89599] (1 species)
  7. 1358533Species Thermotoga maritima [TaxId:2336] [89600] (1 PDB entry)
  8. 1358534Domain d1o1ya_: 1o1y A: [86554]
    structural genomics
    complexed with so4

Details for d1o1ya_

PDB Entry: 1o1y (more details), 1.7 Å

PDB Description: crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution
PDB Compounds: (A:) conserved hypothetical protein TM1158

SCOPe Domain Sequences for d1o1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]}
hhhvrvlairhveiedlgmmedifreknwsfdyldtpkgeklerpleeyslvvllggymg
ayeeekypflkyefqlieeilkkeipflgiclgsqmlakvlgasvyrgkngeeigwyfve
kvsdnkffrefpdrlrvfqwhgdtfdlprratrvftsekyenqgfvygkavglqfhievg
artmkrwieaykdelekkkidprllletaereekvlkgllrsllermves

SCOPe Domain Coordinates for d1o1ya_:

Click to download the PDB-style file with coordinates for d1o1ya_.
(The format of our PDB-style files is described here.)

Timeline for d1o1ya_: