Lineage for d1nwyq_ (1nwy Q:)
- Root: SCOP 1.69
Class i: Low resolution protein structures [58117] (24 folds) 
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) 
Family i.1.1.2: Large subunit [58124] (3 proteins) Protein 50S subunit [58125] (3 species) Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries) 
Domain d1nwyq_: 1nwy Q: [86361]
Details for d1nwyq_
PDB Entry: 1nwy (more details), 3.3 Å
PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
SCOP Domain Sequences for d1nwyq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwyq_ i.1.1.2 (Q:) 50S subunit {Deinococcus radiodurans}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk
SCOP Domain Coordinates for d1nwyq_:
Click to download the PDB-style file with coordinates for d1nwyq_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nwyq_:
- d1nwyq_ first appeared in SCOP 1.65
- d1nwyq_ appears in SCOP 1.67
- d1nwyq_ appears in SCOP 1.71
- d1nwyq_ appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1nwy0_, d1nwy1_, d1nwy2_, d1nwy3_, d1nwy4_, d1nwy9_, d1nwya_, d1nwyb_, d1nwyc_, d1nwyd_, d1nwye_, d1nwyf_, d1nwyg_, d1nwyh_, d1nwyi_, d1nwyj_, d1nwyk_, d1nwyl_, d1nwym_, d1nwyn_, d1nwyo_, d1nwyp_, d1nwyr_, d1nwys_, d1nwyt_, d1nwyu_, d1nwyw_, d1nwyx_, d1nwyy_, d1nwyz_ |
